PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID IGS.gm_26_00138
Common NameCHLNCDRAFT_139785
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family CPP
Protein Properties Length: 930aa    MW: 91236.4 Da    PI: 8.0382
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
IGS.gm_26_00138genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR475e-15528566442
              TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                      k+CnCkkskClk+YC+Cfa+g +C+  C+C++C Nk e+
  IGS.gm_26_00138 528 KKCNCKKSKCLKLYCDCFANGGYCGPACSCSSCANKVEN 566
                      89*********************************9875 PP

2TCR52.41e-16598637140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++++gCnCkks+C+kkYCeCf+ag+ C+e+CkCe+C+N+ 
  IGS.gm_26_00138 598 QHRRGCNCKKSHCMKKYCECFQAGVPCGEHCKCESCHNTA 637
                      5899**********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.5E-11525566IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163431.823526638IPR005172CRC domain
PfamPF036381.2E-11528563IPR005172CRC domain
SMARTSM011141.0E-16598639IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.2E-13601636IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 930 aa     Download sequence    Send to blast
MSSNTPRSNR VRSALPEASP FSSVLARLPD LSPPRTKYTT SFGSLNPMAS PPPANTFGFR  60
QQSAQTPGGG NQGKPIVSFD LLGTTPIKSL QPGDQQLSSP RYDLQSPKFP LFQPSPKQPL  120
GALPTPPSVR LADSSAAGAA ARARFSSPFG SLLDGSSRSG PSPAGGASLA PGRSAAAGQA  180
RFAALFAHAA GTLDEAAAAM GKGDIPPPSA GLHPSYLSPL RPPDGAAPRR PGSGGAVAEA  240
AAAGRDAAAA GDPPQRSGAL AGGAAGLDAI AAAAASAGDR EDEGDAEVAA MLHDGEAEEE  300
EADEAEEEEE EEEEEDDEDF TVGSFRRPAP VRGAGASRAQ QLFQARQRPV RRRQLRFGGS  360
GGGGGEGQEE EPEPAQLVRC TLPQSPICQA VSPAVDGVTF HIARLRDAPT SSASDDGSGS  420
PAHRQRPGAY SLDSPAVQAA THAAVAAALE ASAGAGGARR PARAAAAGAA AAAKAAAEAA  480
GTPMQRRGGA HLARSSSDGG AALPPLTPGE DGVAGPGGAP QALFAGPKKC NCKKSKCLKL  540
YCDCFANGGY CGPACSCSSC ANKVENRAMV AAQREAIKQR NPNAFVQKIE ADAALGGQHR  600
RGCNCKKSHC MKKYCECFQA GVPCGEHCKC ESCHNTAGHS GRRPPGGGAS KRARAGAAAA  660
PQTVSTRQHA TRMSAGGSAL AQQLKAAQAF HAAMAQASAG IATAAGGGAD GGGSQSPGLF  720
PLLQPGPLGA GDGGGGAPLL LPLLLPQGGD APPLPLPAAP DAAPDAAALP ALAAFQAADA  780
ALTAADGAPP SHATPVAALL GPAAAGAATA GGGSGGPGGD TFTFHPISGT DRSGSGSSSG  840
QSTPRAAAAA AAAAAADFAF TLDTPAAAAG AAPPAGASAL EKLLPAAEAG GGAAAAAAAG  900
TAKPASRPGS VRATPTKRKP ARTMTAALM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005843975.10.0hypothetical protein CHLNCDRAFT_139785
TrEMBLE1ZQZ20.0E1ZQZ2_CHLVA; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP3231530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-22Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]